PDB entry 2ve3

View 2ve3 on RCSB PDB site
Description: retinoic acid bound cyanobacterial cyp120a1
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, metal-binding, heme, iron
Deposited on 2007-10-15, released 2008-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.225
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 120
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ve3a_
  • Chain 'B':
    Compound: putative cytochrome p450 120
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ve3b_
  • Heterogens: HEM, REA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ve3A (A:)
    mitsptnlnslpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifis
    galanrflftkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsy
    lpkmdgivqgyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqg
    lfslpiplpntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqpls
    lpelkdqillllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkk
    mpyldqvlqevlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpe
    kfdperftpdgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgq
    nlelvvtpsprpkdnlrvklhslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve3A (A:)
    nslpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrfl
    ftkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgiv
    qgyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpipl
    pntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqi
    llllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvl
    qevlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperft
    pdgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtp
    sprpkdnlrvklhsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ve3B (B:)
    mitsptnlnslpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifis
    galanrflftkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsy
    lpkmdgivqgyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqg
    lfslpiplpntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqpls
    lpelkdqillllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkk
    mpyldqvlqevlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpe
    kfdperftpdgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgq
    nlelvvtpsprpkdnlrvklhslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve3B (B:)
    slpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflf
    tkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivq
    gyleqwgkaneviwypqlrrmtfdvaatlfmgeknpqlfpwfetyiqglfslpiplpntl
    fgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqillll
    faghetltsalssfclllgqhsdirervrqeqnkleltaetlkkmpyldqvlqevlrlip
    pvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpdgsathn
    ppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsprpkdnl
    rvklhsl