PDB entry 2vdl

View 2vdl on RCSB PDB site
Description: re-refinement of integrin alphaiibbeta3 headpiece
Class: cell adhesion/immune system
Keywords: cell adhesion-immune system complex, fibrinogen binding, platelet integrin alphaiibbeta3, glycoprotein, cell adhesion, membrane, integrin, receptor, antagonist, host-virus interaction, pyrrolidone carboxylic acid, transmembrane, phosphorylation, disease mutation, cleavage on pair of basic residues
Deposited on 2007-10-10, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.146
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08514 (0-451)
      • conflict see remark 9 (281)
    Domains in SCOPe 2.07: d2vdla_
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: monoclonal antibody 10e5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VDL (0-220)
    Domains in SCOPe 2.07: d2vdlh1
  • Chain 'L':
    Compound: monoclonal antibody 10e5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VDL (0-213)
    Domains in SCOPe 2.07: d2vdll1, d2vdll2
  • Heterogens: GOL, CA, NAG, CAC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdlA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vdlH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
    dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdlH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
    dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
    kttapsvyplapvcttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdlL (L:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec