PDB entry 2vdi

View 2vdi on RCSB PDB site
Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c192s mutation
Class: lyase
Keywords: vicinal cysteines, co2/o2 specificity, photosynthesis, transit peptide, photorespiration, metal-binding, hydroxylation, oxidoreductase, methylation, chloroplast, calvin cycle, monooxygenase, lyase, rubisco, plastid, magnesium, acetylation, carbon dioxide fixation
Deposited on 2007-10-09, released 2008-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdia1, d2vdia2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdib1, d2vdib2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdic1, d2vdic2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdid1, d2vdid2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdie1, d2vdie2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdif1, d2vdif2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdig1, d2vdig2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
      • engineered mutation (191)
    Domains in SCOPe 2.06: d2vdih1, d2vdih2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdii_
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdij_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdik_
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdil_
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdim_
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdin_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdio_
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdip_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vdiA (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiA (A:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vdiB (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiB (B:)
    kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
    tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
    kalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygr
    avyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtc
    eemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnh
    gihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqd
    wcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleac
    tqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vdiC (C:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiC (C:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vdiD (D:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiD (D:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vdiE (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiE (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vdiF (F:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiF (F:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vdiG (G:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiG (G:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vdiH (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vdiH (H:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eslrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiI (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiJ (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiK (K:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiL (L:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiM (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiN (N:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiO (O:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdiP (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv