PDB entry 2vdc

View 2vdc on RCSB PDB site
Description: the 9.5 a resolution structure of glutamate synthase from cryo-electron microscopy and its oligomerization behavior in solution: functional implications.
Class: oxidoreductase
Keywords: oxidoreductase, amidotransferase, ammonia assimilation, nadp, iron, zymogen, nadph-dependent glutamate synthase, iron sulphur flavoprotein, glutamine amidotransferase, glutamate biosynthesis, amino-acid biosynthesis
Deposited on 2007-10-04, released 2008-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: EM
Resolution: 9.5 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdca1, d2vdca2, d2vdca3
  • Chain 'B':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdcb1, d2vdcb2, d2vdcb3
  • Chain 'C':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdcc1, d2vdcc2, d2vdcc3
  • Chain 'D':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdcd1, d2vdcd2, d2vdcd3
  • Chain 'E':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdce1, d2vdce2, d2vdce3
  • Chain 'F':
    Compound: glutamate synthase [nadph] large chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vdcf1, d2vdcf2, d2vdcf3
  • Chain 'G':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: glutamate synthase [nadph] small chain
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OMT, FMN, AKG, F3S, SF4, FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcA (A:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcB (B:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcC (C:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcD (D:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcE (E:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vdcF (F:)
    cgvgfiaaidgkprrsvvekgiealkavwhrgavdadgktgdgagihvavpqkffkdhvk
    vighrapdnklavgqvflprisldaqeacrciveteilafgyyiygwrqvpinvdiigek
    anatrpeieqiivgnnkgvsdeqfeldlyiirrriekavkgeqindfyicslsarsiiyk
    gmflaeqlttfypdllderfesdfaiyhqrystntfptwplaqpfrmlahngeintvkgn
    vnwmkahetrmehpafgthmqdlkpvigvglsdsgsldtvfevmvragrtapmvkmmlvp
    qaltssqttpdnhkaliqycnsvmepwdgpaalamtdgrwvvggmdrnglrpmrytittd
    gliiggsetgmvkidetqviekgrlgpgemiavdlqsgklyrdrelkdhlatlkpwdkwv
    qntthldelvktaslkgepsdmdkaelrrrqqafgltmedmelilhpmvedgkeaigsmg
    ddspiavlsdkyrglhhffrqnfsqvtnppidslrerrvmslktrlgnlgnildedetqt
    rllqlespvlttaeframrdymgdtaaeidatfpvdggpealrdalrrirqetedavrgg
    athviltdeamgparaaipailatgavhthlirsnlrtftslnvrtaegldthyfavlig
    vgattvnaylaqeaiaerhrrglfgsmplekgmanykkaiddgllkimskmgisvissyr
    gggnfeaiglsralvaehfpamvsrisgiglngiqkkvleqhatayneevvalpvggfyr
    frksgdrhgweggvihtlqqavtndsyttfkkyseqvnkrppmqlrdllelrstkapvpv
    devesitairkrfitpgmsmgalspeahgtlnvamnrigaksdsgeggedparfrpdkng
    dnwnsaikqvasgrfgvtaeylnqcreleikvaqgakpgeggqlpgfkvtemiarlrhst
    pgvmlisppphhdiysiedlaqliydlkqinpdakvtvklvsrsgigtiaagvakanadi
    ilisgnsggtgaspqtsikfaglpwemglsevhqvltlnrlrhrvrlrtdgglktgrdiv
    iaamlgaeefgigtasliamgcimvrqchsntcpvgvcvqddklrqkfvgtpekvvnlft
    flaeevreilaglgfrslnevigrtdllhqvsrgaehlddldlnprlaqvdpgenaryct
    lqgrnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglq
    pghitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnkn
    tiigntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvg
    dnfaagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfa
    aeilndwarevtkfwqvvpkemlnrlevpvhl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.