PDB entry 2vd4

View 2vd4 on RCSB PDB site
Description: structure of small-molecule inhibitor of glmu from haemophilus influenzae reveals an allosteric binding site
Class: transferase
Keywords: glmu, inhibitor, magnesium, cell shape, peptidoglycan synthesis, allosteric, transferase, active site, metal-binding, cell wall biogenesis/degradation, multifunctional enzyme, nucleotidyltransferase, acyltransferase, uridyltransferase
Deposited on 2007-09-28, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vd4a1, d2vd4a2
  • Heterogens: P21, SO4, PG4, PGE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vd4A (A:)
    mtkkalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggd
    lmrthlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketlekliea
    kpengialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasf
    kkwlarvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfq
    nkqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlkn
    vvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgsk
    vnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangat
    igagttitrdvgenelvitrvaqrhiqgwqrpikkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vd4A (A:)
    kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
    thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
    ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
    larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
    asklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvi
    gndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnh
    ltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatiga
    gttitrdvgenelvitrvaqrhiqgwqrpi