PDB entry 2vd0

View 2vd0 on RCSB PDB site
Description: complex structure of prostaglandin d2 synthase at 2.2a.
Class: isomerase
Keywords: prostaglandin biosynthesis, fatty acid biosynthesis, prostaglandin d2 synthase, pgds, asthma, cytoplasm, isomerase, lipid synthesis
Deposited on 2007-09-28, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vd0a1, d2vd0a2
  • Chain 'B':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vd0b1, d2vd0b2
  • Chain 'C':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vd0c1, d2vd0c2
  • Chain 'D':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vd0d1, d2vd0d2
  • Heterogens: GSH, D27, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vd0A (A:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vd0A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vd0B (B:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vd0B (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vd0C (C:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vd0C (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vd0D (D:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vd0D (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl