PDB entry 2vcx

View 2vcx on RCSB PDB site
Description: complex structure of prostaglandin d2 synthase at 2.1a.
Class: isomerase
Keywords: prostaglandin biosynthesis, fatty acid biosynthesis, prostaglandin d2 synthase, pgds, asthma, cytoplasm, isomerase, lipid synthesis
Deposited on 2007-09-27, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcxa1, d2vcxa2
  • Chain 'B':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcxb1, d2vcxb2
  • Chain 'C':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcxc1, d2vcxc2
  • Chain 'D':
    Compound: glutathione-requiring prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vcxd1, d2vcxd2
  • Heterogens: MG, GSH, D26, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vcxA (A:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcxA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vcxB (B:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcxB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vcxC (C:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcxC (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwamfnelltynaphlmqd
    ldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanw
    ikrrpqtkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vcxD (D:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcxD (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl