PDB entry 2vct

View 2vct on RCSB PDB site
Description: glutathione transferase a2-2 in complex with delta-4-andostrene-3-17-dione
Class: transferase
Keywords: andostrene dione, steroid metabolism, transferase, glutathione
Deposited on 2007-09-27, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcta1, d2vcta2
  • Chain 'B':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vctb1, d2vctb2
  • Chain 'C':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vctc1, d2vctc2
  • Chain 'D':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vctd1, d2vctd2
  • Chain 'E':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcte1, d2vcte2
  • Chain 'F':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vctf1, d2vctf2
  • Chain 'G':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vctg1, d2vctg2
  • Chain 'H':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcth1, d2vcth2
  • Heterogens: ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vctA (A:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctA (A:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vctB (B:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctB (B:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vctC (C:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctC (C:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vctD (D:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctD (D:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vctE (E:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctE (E:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vctF (F:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctF (F:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vctG (G:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctG (G:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vctH (H:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vctH (H:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf