PDB entry 2vcr

View 2vcr on RCSB PDB site
Description: glutathione transferase a2-2 in complex with glutathione
Class: transferase
Keywords: glutathione-s-transferase, glutathione, polymorphism cytoplasm, transferase
Deposited on 2007-09-26, released 2008-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcra1, d2vcra2
  • Chain 'B':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrb1, d2vcrb2
  • Chain 'C':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrc1, d2vcrc2
  • Chain 'D':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrd1, d2vcrd2
  • Chain 'E':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcre1, d2vcre2
  • Chain 'F':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrf1, d2vcrf2
  • Chain 'G':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrg1, d2vcrg2
  • Chain 'H':
    Compound: glutathione s-transferase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09210 (Start-221)
      • variant see remark 99 (111)
    Domains in SCOPe 2.07: d2vcrh1, d2vcrh2
  • Heterogens: GSW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vcrA (A:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrA (A:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vcrB (B:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrB (B:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vcrC (C:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrC (C:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vcrD (D:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrD (D:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vcrE (E:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrE (E:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vcrF (F:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrF (F:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vcrG (G:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrG (G:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vcrH (H:)
    maekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdak
    laliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleesrkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vcrH (H:)
    aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikekalidmyiegiadlgemilllpftqpeeqdakl
    aliqektknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleesrkifrf