PDB entry 2vco

View 2vco on RCSB PDB site
Description: Crystal structure of the fimbrial adhesin FimH in complex with its high-mannose epitope
Class: cell adhesion
Keywords: pili, glycan, mannose, cell adhesion
Deposited on 2007-09-26, released 2008-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vcoa_
  • Chain 'B':
    Compound: protein fimh
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vcob_
  • Heterogens: NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vcoA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vcoB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt