PDB entry 2vcd

View 2vcd on RCSB PDB site
Description: Solution structure of the FKBP-domain of Legionella pneumophila Mip in complex with rapamycin
Class: isomerase
Keywords: mip, fkbp, ppiase, membrane, rotamase, sirolimus, virulence, isomerase, rapamycin, fkbp-domain, outer membrane, legionnaires disease, macrolide antibiotic, legionella pneumophila
Deposited on 2007-09-20, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: outer membrane protein mip
  Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
  Gene: mip, lpg0791
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5ZXE0 (0-136)
  Domains in SCOPe 2.08: d2vcda_
• Heterogens: RAP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vcdA (A:)
  fnkkadenkvkgeafltenknkpgvvvlpsglqykvinsgngvkpgksdtvtveytgrli
  dgtvfdstektgkpatfqvsqvipgwtealqlmpagstweiyvpsglaygprsvggpigp
  netlifkihlisvkkss