PDB entry 2vc6

View 2vc6 on RCSB PDB site
Description: structure of mosa from s. meliloti with pyruvate bound
Class: lyase
Keywords: dhdps, tim barrel, schiff base, lyase
Deposited on 2007-09-18, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.214
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydrodipicolinate synthase
    Species: SINORHIZOBIUM MELILOTI [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VC6 (0-291)
    Domains in SCOPe 2.07: d2vc6a_
  • Chain 'B':
    Compound: Dihydrodipicolinate synthase
    Species: SINORHIZOBIUM MELILOTI [TaxId:382]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VC6 (0-291)
    Domains in SCOPe 2.07: d2vc6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vc6A (A:)
    mfegsitalvtpfaddridevalhdlvewqieegsfglvpcgttgesptlskseheqvve
    itiktangrvpviagagsnstaeaiafvrhaqnagadgvlivspyynkptqegiyqhfka
    idaastipiivynipgrsaieihvetlarifedcpnvkgvkdatgnllrpslermacged
    fnlltgedgtalgymahgghgcisvtanvapalcadfqqaclngdfaaalklqdrlmplh
    ralfletnpagakyalqrlgrmrgdlrlplvtispsfqeeiddamrhagill
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vc6B (B:)
    mfegsitalvtpfaddridevalhdlvewqieegsfglvpcgttgesptlskseheqvve
    itiktangrvpviagagsnstaeaiafvrhaqnagadgvlivspyynkptqegiyqhfka
    idaastipiivynipgrsaieihvetlarifedcpnvkgvkdatgnllrpslermacged
    fnlltgedgtalgymahgghgcisvtanvapalcadfqqaclngdfaaalklqdrlmplh
    ralfletnpagakyalqrlgrmrgdlrlplvtispsfqeeiddamrhagill