PDB entry 2vb6

View 2vb6 on RCSB PDB site
Description: myosin vi (md-insert2-cam, delta insert1) post-rigor state (crystal form 2)
Class: motor protein
Keywords: myosin vi, post-rigor state, mg.ADP.befx, calmodulin, cam, molecular motor, motor protein
Deposited on 2007-09-06, released 2007-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin vi
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122 (350-End)
      • conflict (519)
      • conflict (544-545)
      • conflict (686)
      • conflict (693-694)
  • Chain 'B':
    Compound: calmodulin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62149
      • conflict (99)
      • conflict (120)
      • conflict (143)
      • conflict (147)
    Domains in SCOPe 2.06: d2vb6b_
  • Heterogens: ADP, BEF, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vb6B (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemiresdidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vb6B (B:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
    emiresdidgdgqvnyeefvtmmts