PDB entry 2vb2

View 2vb2 on RCSB PDB site
Description: crystal structure of cu(i)cusf
Deposited on 2007-09-06, released 2007-12-18
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.239
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Cation efflux system protein cusF
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >2vb2X (X:)
nehhhetmseaqpqvisatgvvkgidleskkitihhdpiaavnwpemtmrftitpqtkms
eiktgdkvafnfvqqgnlsllqdikvsq

    Sequence, based on observed residues (ATOM records):
    >2vb2X (X:)
pqvisatgvvkgidleskkitihhdpiaavnwpemtmrftitpqtkmseiktgdkvafnf
vqqgnlsllqdikvsq