PDB entry 2vaz

View 2vaz on RCSB PDB site
Description: model of the s15-mrna complex fitted into the cryo-em map of the 70s entrapment complex.
Deposited on 2007-09-05, released 2007-10-02
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rpso mRNA operator
    Species: Escherichia coli, synthetic [TaxId:562]
  • Chain 'F':
    Compound: 30S ribosomal protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAZ
    • Uniprot P0ADZ4 (1-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records:
    >2vazF (F:)
mslsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmv
sqrrklldylkrkdvarytqlierlglrr

    Sequence, based on observed residues (ATOM records):
    >2vazF (F:)
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytqlierlgl