PDB entry 2vaw

View 2vaw on RCSB PDB site
Description: ftsz pseudomonas aeruginosa GDP
Class: cell cycle
Keywords: bacterial cell division protein, tubulin homolog, nucleotide-binding, gtpase, septation, cytoplasm, cell cycle, GTP-binding, cell division, polymerization
Deposited on 2007-09-04, released 2007-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2063
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vawa1, d2vawa2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vawA (A:)
    mfelvdniaqtavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlq
    lgpgvtkglgaganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaev
    akemgiltvavvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasll
    aafakaddvlagavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrarea
    teaairnplledvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvid
    admrdelhvtvvatglgarlekpvkvvdntvqgsaaqaaapaqreqqsvnyrdldrptvm
    rnqshgsaataaklnpqddldyldipaflrrqad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vawA (A:)
    felvdniaqtavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlql
    gpgvtkglgaganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaeva
    kemgiltvavvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdaslla
    afakaddvlagavrgisdiikrpgminvdfadvktvmsemgmammgtgcasgpnrareat
    eaairnplledvnlqgargilvnitagpdlslgeysdvgniieqfasehatvkvgtvida
    dmrdelhvtvvatgl