PDB entry 2vav

View 2vav on RCSB PDB site
Description: crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
Class: transferase
Keywords: acetyl transferase, a/b- hydrolase fold, transferase, acyltransferase, acetyl coenzyme a, antibiotic biosynthesis, cephalosporin biosynthesis
Deposited on 2007-09-04, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vava_
  • Chain 'B':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavb_
  • Chain 'C':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavc_
  • Chain 'D':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavd_
  • Chain 'E':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vave_
  • Chain 'F':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavf_
  • Chain 'G':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavg_
  • Chain 'H':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavh_
  • Chain 'I':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavi_
  • Chain 'J':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavj_
  • Chain 'K':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavk_
  • Chain 'L':
    Compound: acetyl-coa--deacetylcephalosporin c acetyltransferase
    Species: ACREMONIUM CHRYSOGENUM [TaxId:5044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vavl_
  • Heterogens: CSC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vavA (A:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavA (A:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaerpygakfprttirddvr
    ihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfet
    qrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvgqpieav
    ssylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdg
    lysfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vavB (B:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavB (B:)
    anrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahv
    tswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaqrpygakfprttirddv
    rihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfe
    tqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvgqpiea
    vssylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsd
    glysfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vavC (C:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavC (C:)
    ianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssah
    vtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprttir
    ddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaa
    wfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavs
    sylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdgl
    ysfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vavD (D:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavD (D:)
    ianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssah
    vtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaqrpygakfprttirdd
    vrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawf
    etqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavssy
    lryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglys
    fdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vavE (E:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavE (E:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdapygakfprttirddvrih
    rqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqr
    qciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvgqpieavss
    ylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdgly
    sfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vavF (F:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavF (F:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdapygakfprttirddvrih
    rqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqr
    qciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavssylryq
    aqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfdeh
    vemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vavG (G:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavG (G:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdarpygakfprttirddvri
    hrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetq
    rqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavssylry
    qaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfde
    hvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vavH (H:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavH (H:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaerpygakfprttirddvr
    ihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfet
    qrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavssylr
    yqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfd
    ehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vavI (I:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavI (I:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdarpygakfprttirddvri
    hrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetq
    rqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvgqpieavs
    sylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdgl
    ysfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldqs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vavJ (J:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavJ (J:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdapygakfprttirddvrih
    rqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqr
    qciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmgqpieavssylry
    qaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfde
    hvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldqsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vavK (K:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavK (K:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpygakfprttirddvrihrqv
    ldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqrqci
    yddpkyldgeydvddqpvrgletarkianltykskpamderfhmgqpieavssylryqaq
    kfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfdehve
    mgrsipnsrlcvvdtneghdffvmeadkvndavrgfldqsl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vavL (L:)
    mlpsaqvarlkpdpfppslspiphgavtfaalapchnlpifssrqmlrdsltyshtsptm
    spqianrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtlts
    sahvtswwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprt
    tirddvrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgw
    caawfetqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgv
    qagrnissqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkf
    dthdisrgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneg
    hdffvmeadkvndavrgfldqslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vavL (L:)
    nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
    swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdpygakfprttirddvrihr
    qvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqrq
    ciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmqpieavssylryqa
    qkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfdehv
    emgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq