PDB entry 2vau

View 2vau on RCSB PDB site
Description: isopenicillin n synthase with substrate analogue acomp (unexposed)
Class: oxidoreductase
Keywords: oxidoreductase, antibiotic biosynthesis, penicillin biosynthesis, iron, oxygenase, vitamin c, metal-binding, monocyclic intermediate, b-lactam antibiotic
Deposited on 2007-09-04, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.152
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isopenicillin n synthetase
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vaua_
  • Heterogens: FE2, V20, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vauA (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vauA (A:)
    svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
    msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
    thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
    svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
    eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
    ngksdreplsygdylqnglvslinkngqt