PDB entry 2vas

View 2vas on RCSB PDB site
Description: myosin vi (md-insert2-cam, delta-insert1) post-rigor state
Class: motor protein
Keywords: calmodulin-binding, nucleotide-binding, transport, calmodulin, endocytosis, mg.ADP.befx, cam, myosin, nucleus, membrane, myosin vi, cytoplasm, golgi apparatus, phosphorylation, molecular motor, ATP-binding, coiled coil, actin-binding, motor protein, post-rigor state, protein transport
Deposited on 2007-09-04, released 2007-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-11, with a file datestamp of 2007-12-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21865
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin vi
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122 (350-787)
      • conflict (519)
      • conflict (544-545)
      • conflict (686)
      • conflict (693-694)
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vasb1
  • Heterogens: MG, CA, ADP, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vasB (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vasB (B:)
    lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
    dfpefltmmardtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemir
    eadidgdgqvnyeefvtmmts