PDB entry 2vap

View 2vap on RCSB PDB site
Description: ftsz GDP m. jannaschii
Class: cell cycle
Keywords: cell division, polymerization, tubulin homolog, gtpase, septation, cell cycle, GTP-binding, nucleotide-binding, bacterial cell division protein
Deposited on 2007-09-03, released 2007-09-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz homolog 1
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vapa1, d2vapa2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vapA (A:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vapA (A:)
    lelspedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirt
    kadkkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgs
    apvvaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeiv
    pnmplklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdse
    krakeavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiw
    gatidenlentvrvllvitgvqsrieftdtglkrk