PDB entry 2van

View 2van on RCSB PDB site
Description: nucleotidyl transfer mechanism of mismatched dNTP incorporation by DNA polymerase b by structural and kinetic analyses
Class: transferase
Keywords: nucleotidyltransferase, DNA-directed DNA polymerase, lyase, nucleus, DNA damage, DNA synthesis, DNA replication, DNA repair, transferase, DNA-binding, metal-binding
Deposited on 2007-09-03, released 2008-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerse beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06766 (0-244)
      • engineered mutation (169)
    Domains in SCOPe 2.06: d2vana1, d2vana2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vanA (A:)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlqpkdqyycgvl
    yftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrep
    kdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vanA (A:)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpseyphrridirlqpkdqyycgvlyftgs
    difnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdrse