PDB entry 2vae

View 2vae on RCSB PDB site
Description: fast maturing red fluorescent protein, dsred.t4
Class: fluorescent protein
Keywords: photoprotein, fast maturing, fluorescent protein, dsred, gfp-like, chromophore, luminescence
Deposited on 2007-08-31, released 2007-11-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.163
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaea_
  • Chain 'B':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaeb_
  • Chain 'C':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaec_
  • Chain 'D':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaed_
  • Chain 'E':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaee_
  • Chain 'F':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaef_
  • Chain 'G':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaeg_
  • Chain 'H':
    Compound: red fluorescent protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VAE (Start-224)
    Domains in SCOPe 2.01: d2vaeh_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vaeA (A:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeA (A:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vaeB (B:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeB (B:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vaeC (C:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeC (C:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vaeD (D:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeD (D:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vaeE (E:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeE (E:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vaeF (F:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeF (F:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vaeG (G:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeG (G:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vaeH (H:)
    massedvikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfqygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiy
    kvkfigvnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksi
    ymakkpvqlpgyyyvdsklditshnedytiveqyeraegrhhlfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vaeH (H:)
    vikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfq
    ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
    vnfpsdgpvmqkktmgwepsterlyprdgvlkgeihkalklkdgghylvefksiymakkp
    vqlpgyyyvdsklditshnedytiveqyeraegrhhlfl