PDB entry 2va3

View 2va3 on RCSB PDB site
Description: complex structure of sulfolobus solfataricus dpo4 and DNA duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand
Class: transferase
Keywords: DNA-directed DNA polymerase, p2 DNA polymerase IV, nucleotidyltransferase, mutator protein, DNA replication, 2, 4-difluorotoluene, DNA repair, DNA-binding, transferase, metal-binding, translesion DNA polymerase, dgtp, cytoplasm, magnesium, DNA damage
Deposited on 2007-08-28, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VA3 (6-23)
    • Uniprot Q97W02 (6-End)
    Domains in SCOPe 2.07: d2va3a1, d2va3a2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *cp*tp*a)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*tp*cp*ap*dftp*tp*ap*gp*tp*cp*cp *tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: DGT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2va3A (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2va3A (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfiea
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.