PDB entry 2v9t

View 2v9t on RCSB PDB site
Description: Complex between the second LRR domain of Slit2 and The first Ig domain from Robo1
Class: structural protein/receptor
Keywords: structural protein-receptor complex, developmental protein, ig domain, roundabout, chemotaxis, lrr domain, immunoglobulin domain, leucine-rich repeat, neuronal development, phosphorylation, egf-like domain, disease mutation, slit2, ligand, membrane, secreted, receptor, neurogenesis, glycoprotein, transmembrane, proto-oncogene, differentiation structural protein/receptor, complex
Deposited on 2007-08-25, released 2007-09-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V9T
      • engineered mutation (101)
    • Uniprot Q9Y6N7 (2-107)
    Domains in SCOPe 2.04: d2v9ta_
  • Chain 'B':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V9T
    • Uniprot O94813 (2-End)
    Domains in SCOPe 2.04: d2v9tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v9tA (A:)
    gslrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprsh
    rmllpsgslfflrivhgrksrpdegvyvcvarnylgeavshdaslevaaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9tA (A:)
    slrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprshr
    mllpsgslfflrivhgrksrpdegvyvcvarnylgeavshdasleva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v9tB (B:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrcsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9tB (B:)
    gslhcpaactcsnnivdcrgkglteiptnlpetiteirleqntikvippgafspykklrr
    idlsnnqiselapdafqglrslnslvlygnkitelpkslfeglfslqllllnankinclr
    vdafqdlhnlnllslydnklqtiakgtfsplraiqtmhlaqnpficdchlkwladylhtn
    pietsgarctsprrlankrigqikskkfrc