PDB entry 2v9r

View 2v9r on RCSB PDB site
Description: first and second ig domains from human robo1 (form 2)
Class: receptor
Keywords: proto-oncogene, differentiation, phosphorylation, disease mutation, neuronal development, immunoglobulin domain, chemotaxis, neurogenesis, glycoprotein, transmembrane, robo1, membrane, receptor, ig domain, roundabout, developmental protein
Deposited on 2007-08-25, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.261
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V9R
      • engineered mutation (101)
    • Uniprot Q9Y6N7
    Domains in SCOPe 2.07: d2v9ra1, d2v9ra2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v9rA (A:)
    gslrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprsh
    rmllpsgslfflrivhgrksrpdegvyvcvarnylgeavshdaslevailrddfrqnpsd
    vmvavgepavmecqpprghpeptiswkkdgsplddkderitirggklmitytrksdagky
    vcvgtnmvgeresevaeltvlerpsfvkaaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9rA (A:)
    edfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprshrmllp
    sgslfflrivhgrksrpdegvyvcvarnylgeavshdaslevailrddfrqnpsdvmvav
    gepavmecqpprghpeptiswkkdgsplddkderitirggklmitytrksdagkyvcvgt
    nmvgeresevaeltvle