PDB entry 2v9q

View 2v9q on RCSB PDB site
Description: first and second ig domains from human robo1
Class: receptor
Keywords: proto-oncogene, differentiation, phosphorylation, disease mutation, neuronal development, immunoglobulin domain, chemotaxis, neurogenesis, glycoprotein, transmembrane, robo1, membrane, receptor, ig domain, roundabout, developmental protein
Deposited on 2007-08-25, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: roundabout homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V9Q (208-End)
      • engineered mutation (101)
    • Uniprot Q9Y6N7 (2-207)
    Domains in SCOPe 2.06: d2v9qa1, d2v9qa2
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v9qA (A:)
    gslrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprsh
    rmllpsgslfflrivhgrksrpdegvyvcvarnylgeavshdaslevailrddfrqnpsd
    vmvavgepavmecqpprghpeptiswkkdgsplddkderitirggklmitytrksdagky
    vcvgtnmvgeresevaeltvlerpsfvkaaah
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9qA (A:)
    lrqedfpprivehpsdlivskgepatlnckaegrptptiewykggervetdkddprshrm
    llpsgslfflrivhgrksrpdegvyvcvarnylgeavshdaslevailrddfrqnpsdvm
    vavgepavmecqpprghpeptiswkkdgsplddkderitirggklmitytrksdagkyvc
    vgtnmvgeresevaeltvlerpsfvkaa