PDB entry 2v9l

View 2v9l on RCSB PDB site
Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant q6y- e192a)
Class: lyase
Keywords: entropy index, metal-binding, oligomerization, zinc, lyase, aldolase, class II, cytoplasm, cleavage of l-rhamnulose-1-phosphate to dihydroxyacetoneph bacterial l-rhamnose metabolism, interface design, surface mutation, 2-ketose degradation, protein-protein interface, rare sugar, aggregation, zinc enzyme, fibrillation, rhamnose metabolism, protein engineering
Deposited on 2007-08-24, released 2008-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32169 (0-273)
      • engineered mutation (5)
      • engineered mutation (191)
    Domains in SCOPe 2.08: d2v9la_
  • Heterogens: ZN, PO4, ACT, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v9lA (A:)
    mqnityswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal