PDB entry 2v9f

View 2v9f on RCSB PDB site
Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant e192a-k248w-a273s)
Class: lyase
Keywords: entropy index, metal-binding, oligomerization, zinc, lyase, aldolase, class II, cytoplasm, cleavage of l-rhamnulose-1-phosphate to dihydroxyacetoneph bacterial l-rhamnose metabolism, interface design, surface mutation, 2-ketose degradation, protein-protein interface, rare sugar, aggregation, zinc enzyme, fibrillation, rhamnose metabolism, protein engineering
Deposited on 2007-08-23, released 2008-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32169 (0-273)
      • engineered mutation (191)
      • engineered mutation (247)
      • engineered mutation (272)
    Domains in SCOPe 2.08: d2v9fa_
  • Heterogens: ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v9fA (A:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmwqtisreelialgkrfgvtplasalsl