PDB entry 2v9a

View 2v9a on RCSB PDB site
Description: structure of citrate-free periplasmic domain of sensor histidine kinase cita
Class: transferase
Keywords: signal transduction, sensor histidine kinase, cita, kinase, membrane, transferase, sensor domain, transmembrane, inner membrane, phosphorylation, two-component regulatory system
Deposited on 2007-08-23, released 2008-03-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2124
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v9aa_
  • Chain 'B':
    Compound: Sensor kinase citA
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2v9ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v9aA (A:)
    mditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvg
    dasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvi
    givsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9aA (A:)
    teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
    gqrlnaksyvsvrkgslgsslrgkspiqdatgkvigivsvgytie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v9aB (B:)
    mditeerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvg
    dasgqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvi
    givsvgytieqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v9aB (B:)
    teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
    gqrlyinaksyvsvrkgslgsslrgkspiqdatgkvigivsvgyti