PDB entry 2v8e

View 2v8e on RCSB PDB site
Description: crystal structure of human complement factor h, scr domains 6-8 (h402 risk variant), in complex with ligand.
Deposited on 2007-08-07, released 2007-10-02
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor h
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V8E (0-1)
    • Uniprot P08603 (2-186)
  • Heterogens: CL, SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2v8eA (A:)
    mglkpcdypdikhgglyhenmrrpyfpvavgkyysyycdehfetpsgsywdhihctqdgw
    spavpclrkcyfpylengynqnhgrkfvqgksidvachpgyalpkaqttvtcmengwspt
    prcirvktcskssidiengfisesqytyalkekakyqcklgyvtadgetsgsitcgkdgw
    saqptci