PDB entry 2v85

View 2v85 on RCSB PDB site
Description: Crystal structure of RAG2-PHD finger in complex with H3R2me1K4me3 peptide
Class: protein binding
Keywords: v(d)j recombination, covalent modifications, rag2, histone, nucleus, nuclease, hydrolase, phd finger, DNA-binding, recombinase, endonuclease, trimethyl lysine, DNA recombination, protein binding
Deposited on 2007-08-02, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vdj recombination-activating protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V85
  • Uniprot P21784 (8-81)
  Domains in SCOPe 2.08: d2v85a_
• Chain 'B':
  Compound: vdj recombination-activating protein 2
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V85 (0-7)
  • Uniprot P21784 (8-81)
  Domains in SCOPe 2.08: d2v85b2, d2v85b3
• Chain 'D':
  Compound: h3r2me1k4me3 peptide
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6 (0-11)
    • conflict (9-10)
• Chain 'E':
  Compound: h3r2me1k4me3 peptide
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6 (0-End)
    • conflict (9)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2v85A (A:)
  gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
  lihlsegsnkyycnehvqiara
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v85A (A:)
  gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
  nkyycnehvqiara
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2v85B (B:)
  gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
  lihlsegsnkyycnehvqiara
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.