PDB entry 2v7x

View 2v7x on RCSB PDB site
Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
Class: transferase
Keywords: fluorinase, transferase, biosynthetic protein
Deposited on 2007-08-02, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70GK9
      • engineered mutation (157)
    Domains in SCOPe 2.06: d2v7xa1, d2v7xa2
  • Chain 'B':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70GK9
      • engineered mutation (157)
    Domains in SCOPe 2.06: d2v7xb1, d2v7xb2
  • Chain 'C':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70GK9
      • engineered mutation (157)
    Domains in SCOPe 2.06: d2v7xc1, d2v7xc2
  • Heterogens: MET, 5FD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v7xA (A:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7xA (A:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v7xB (B:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7xB (B:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v7xC (C:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7xC (C:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea