PDB entry 2v7n

View 2v7n on RCSB PDB site
Description: Unusual twinning in crystals of the CitS binding antibody Fab fragment f3p4
Class: immune system
Keywords: binding protein, recombinant fab fragment, synthetic antibody library (hucal), phage display, immune system
Deposited on 2007-07-31, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.1553
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N (0-End)
    Domains in SCOPe 2.07: d2v7na1, d2v7na2
  • Chain 'B':
    Compound: immunoglobulin heavy chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N
  • Chain 'C':
    Compound: immunoglobulin light chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N (0-End)
    Domains in SCOPe 2.07: d2v7nc1, d2v7nc2
  • Chain 'D':
    Compound: immunoglobulin heavy chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N
  • Chain 'E':
    Compound: immunoglobulin light chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N (0-End)
    Domains in SCOPe 2.07: d2v7ne1, d2v7ne2
  • Chain 'F':
    Compound: immunoglobulin heavy chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N
  • Chain 'G':
    Compound: immunoglobulin light chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N (0-End)
    Domains in SCOPe 2.07: d2v7ng1, d2v7ng2
  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7N
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v7nA (A:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7nA (A:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v7nC (C:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7nC (C:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v7nE (E:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7nE (E:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2v7nG (G:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7nG (G:)
    divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
    arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'H':
    No sequence available.