PDB entry 2v7a

View 2v7a on RCSB PDB site
Description: crystal structure of the t315i abl mutant in complex with the inhibitor pha-739358
Class: transferase
Keywords: kinase, nucleus, myristate, cytoplasm, manganese, cell adhesion, metal-binding, proto-oncogene, tyrosine-protein kinase, chromosomal rearrangement, transferase, lipoprotein, polymorphism, cytoskeleton, magnesium, sh2 domain, sh3 domain, ATP-binding, nucleotide-binding, alternative splicing, phosphorylation, kinase inhibitor, t315i abl mutant
Deposited on 2007-07-27, released 2007-09-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7A
      • engineered mutation (88)
    • Uniprot P00519
    Domains in SCOPe 2.05: d2v7aa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2V7A
      • engineered mutation (88)
    • Uniprot P00519
    Domains in SCOPe 2.05: d2v7ab_
  • Heterogens: 627, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v7aA (A:)
    gpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflke
    aavmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatq
    issameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwt
    apeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpe
    kvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7aA (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v7aB (B:)
    gpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflke
    aavmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatq
    issameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwt
    apeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpe
    kvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v7aB (B:)
    kwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkei
    khpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatqissamey
    lekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslay
    nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
    acwqwnpsdrpsfaeihqafetmfqessis