PDB entry 2v77

View 2v77 on RCSB PDB site
Description: crystal structure of human carboxypeptidase a1
Class: hydrolase
Keywords: metal-binding, metalloprotease, carboxypeptidase, protein degradation, zinc, zymogen, protease, secreted, hydrolase
Deposited on 2007-07-27, released 2008-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1782
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v77a_
  • Chain 'B':
    Compound: Carboxypeptidase A1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v77b_
  • Heterogens: PAY, ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v77A (A:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v77A (A:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v77B (B:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v77B (B:)
    arstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrp
    aiwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafth
    stnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksiv
    dfvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfny
    gsiikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlallti
    mehtlnhp