PDB entry 2v76

View 2v76 on RCSB PDB site
Description: crystal structure of the human dok1 ptb domain
Class: protein-binding
Keywords: alternative splicing, protein-binding, ptb domain, phosphorylation, adaptor protein
Deposited on 2007-07-26, released 2008-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Docking protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V76 (0-1)
    • Uniprot Q53TY2 (2-End)
    Domains in SCOPe 2.07: d2v76a_
  • Chain 'B':
    Compound: Docking protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v76b_
  • Chain 'C':
    Compound: Docking protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v76c_
  • Chain 'D':
    Compound: Docking protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2v76d_
  • Heterogens: PGE, SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v76A (A:)
    plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
    grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqkaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v76A (A:)
    plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgilepllswpytllrrygrdk
    vmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v76B (B:)
    plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
    grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqkaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v76B (B:)
    sqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrrygrd
    kvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v76C (C:)
    plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
    grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqkaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v76C (C:)
    sqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrrygrd
    kvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v76D (D:)
    plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
    grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrqkaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v76D (D:)
    sqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrrygrd
    kvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihr