PDB entry 2v73

View 2v73 on RCSB PDB site
Description: the structure of the family 40 cbm from c. perfringens nanj in complex with a sialic acid containing molecule
Deposited on 2007-07-25, released 2007-08-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative exo-alpha-sialidase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V73
    • Uniprot Q0TTQ4 (Start-190)
  • Chain 'B':
    Compound: putative exo-alpha-sialidase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V73
    • Uniprot Q0TTQ4 (Start-190)
  • Heterogens: CA, SIA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2v73A (A:)
    gmasikgevdeianygnlkitkeeervnitgdlekfssleegtivtrfnmndtsiqslig
    lsdgnkannyfslyvsggkvgyelrrqegngdfnvhhsadvtfnrgintlalkiekgiga
    kiflngslvktvsdpnikflnainlnsgfigktdrangyneylfrgnidfmniydkpvsd
    nyllrktgetk
    

    Sequence, based on observed residues (ATOM records):
    >2v73A (A:)
    vdeianygnlkitkeeervnitgdlekfssleegtivtrfnmndtsiqsliglsdgnkan
    nyfslyvsggkvgyelrrqegngdfnvhhsadvtfnrgintlalkiekgigakiflngsl
    vktvsdpnikflnainlnsgfigktdrangyneylfrgnidfmniydkpvsdnyllrktg
    etk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2v73B (B:)
    gmasikgevdeianygnlkitkeeervnitgdlekfssleegtivtrfnmndtsiqslig
    lsdgnkannyfslyvsggkvgyelrrqegngdfnvhhsadvtfnrgintlalkiekgiga
    kiflngslvktvsdpnikflnainlnsgfigktdrangyneylfrgnidfmniydkpvsd
    nyllrktgetk
    

    Sequence, based on observed residues (ATOM records):
    >2v73B (B:)
    deianygnlkitkeeervnitgdlekfssleegtivtrfnmndtsiqsliglsdgnkann
    yfslyvsggkvgyelrrqegngdfnvhhsadvtfnrgintlalkiekgigakiflngslv
    ktvsdpnikflnainlnsgfigktdrangyneylfrgnidfmniydkpvsdnyllrktge
    tk