PDB entry 2v72

View 2v72 on RCSB PDB site
Description: the structure of the family 32 cbm from c. perfringens nanj in complex with galactose
Deposited on 2007-07-25, released 2007-08-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-alpha-sialidase
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V72
    • Uniprot Q8XMY5 (Start-142)
  • Heterogens: CA, GAL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2v72A (A:)
    gmasaiietaipqsemtasatseegqdpassaidgnintmwhtkwngsdalpqslsvnlg
    karkvssiaitprtsgnngfitkyeihainngvetlvaegtweennlvktvtfdspidae
    eikitaiqgvggfasiaelnvye
    

    Sequence, based on observed residues (ATOM records):
    >2v72A (A:)
    ietaipqsemtasatseegqdpassaidgnintmwhtkwngsdalpqslsvnlgkarkvs
    siaitprtsgnngfitkyeihainngvetlvaegtweennlvktvtfdspidaeeikita
    iqgvggfasiaelnvye