PDB entry 2v70

View 2v70 on RCSB PDB site
Description: third lrr domain of human slit2
Class: structural protein
Keywords: neurogenesis, glycoprotein, slit2, secreted, chemotaxis, lrr domain, structural protein, differentiation, egf-like domain, leucine-rich repeat, developmental protein
Deposited on 2007-07-24, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.225
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V70
    • Uniprot O94813 (Start-212)
    Domains in SCOPe 2.07: d2v70a_
  • Chain 'B':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V70
    • Uniprot O94813 (Start-212)
    Domains in SCOPe 2.07: d2v70b_
  • Chain 'C':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V70
    • Uniprot O94813 (Start-212)
    Domains in SCOPe 2.07: d2v70c_
  • Chain 'D':
    Compound: slit homolog 2 protein n-product
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V70
    • Uniprot O94813 (Start-212)
    Domains in SCOPe 2.07: d2v70d_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v70A (A:)
    gslacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlr
    kinfsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcv
    gndsfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrk
    krivtgnprcqkpyflkeipiqdvaiqdftcddahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v70A (A:)
    acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
    fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
    sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
    vtgnprcqkpyflkeipiqdvaiqdftcdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v70B (B:)
    gslacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlr
    kinfsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcv
    gndsfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrk
    krivtgnprcqkpyflkeipiqdvaiqdftcddahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v70B (B:)
    acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
    fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
    sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
    vtgnprcqkpyflkeipiqdvaiqdftcdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v70C (C:)
    gslacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlr
    kinfsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcv
    gndsfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrk
    krivtgnprcqkpyflkeipiqdvaiqdftcddahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v70C (C:)
    acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
    fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
    sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
    vtgnprcqkpyflkeipiqdvaiqdftcdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v70D (D:)
    gslacpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlr
    kinfsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcv
    gndsfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrk
    krivtgnprcqkpyflkeipiqdvaiqdftcddahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v70D (D:)
    acpekcrcegttvdcsnqklnkipehipqytaelrlnnneftvleatgifkklpqlrkin
    fsnnkitdieegafegasgvneilltsnrlenvqhkmfkgleslktlmlrsnritcvgnd
    sfiglssvrllslydnqittvapgafdtlhslstlnllanpfncncylawlgewlrkkri
    vtgnprcqkpyflkeipiqdvaiqdftcdd