PDB entry 2v6z

View 2v6z on RCSB PDB site
Description: solution structure of amino-terminal domain of human dna polymerase epsilon subunit b
Deposited on 2007-07-24, released 2008-08-05
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: DNA polymerase epsilon subunit 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56282 (24-98)
      • engineered mutation (97)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'M':
    Sequence, based on SEQRES records:
    >2v6zM (M:)
mgsshhhhhhsqdpnsssarlqvdmaperlrsralsafklrglllrgeaikyltealqsi
seleledklekiinavekqplssnmiersvveaavqess

    Sequence, based on observed residues (ATOM records):
    >2v6zM (M:)
maperlrsralsafklrglllrgeaikyltealqsiseleledklekiinavekqplssn
miersvveaavqess