PDB entry 2v6x

View 2v6x on RCSB PDB site
Description: Stractural insight into the interaction between ESCRT-III and Vps4
Class: protein transport
Keywords: protein transport, vacuole, endosome, transport, escrt-III, mvb, vps2, vps4, skd1, vps4b, vps4a, chmp2b, chmp2a, nucleotide-binding, aaa-ATPase, ATP-binding, multivesicular, vacuolar protein sorting
Deposited on 2007-07-23, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vacuolar protein sorting-associated protein 4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V6X (Start-2)
  • Uniprot P52917 (3-End)
  Domains in SCOPe 2.08: d2v6xa1, d2v6xa2
• Chain 'B':
  Compound: doa4-independent degradation protein 4
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • PDB 2V6X (Start-3)
  • Uniprot P36108 (4-End)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2v6xA (A:)
  gshmstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlir
  akfteylnraeqlkkhleseeanaa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v6xA (A:)
  shmstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlira
  kfteylnraeqlkkhleseean
  

  
  
• Chain 'B':
  No sequence available.