PDB entry 2v6n

View 2v6n on RCSB PDB site
Description: Crystal structures of the SARS-coronavirus main proteinase inactivated by benzotriazole compounds
Class: viral protein
Keywords: thiol protease, RNA replication, main proteinase, ribosomal frameshift, sars, protease, hydrolase, polyprotein, viral protein
Deposited on 2007-07-19, released 2008-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1ab
    Species: Human SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v6na_
  • Heterogens: XP1, MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2v6nA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq