PDB entry 2v6k

View 2v6k on RCSB PDB site
Description: Structure of Maleyl Pyruvate Isomerase, a bacterial glutathione-s- transferase in Zeta class, in complex with substrate analogue dicarboxyethyl glutathione
Class: isomerase
Keywords: glutathione-s-transferase, gst, plasmid, pyruvate, bacterial, isomerase, biodegradation, maleyl pyruvate, fumaryl pyruvate
Deposited on 2007-07-19, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maleylpyruvate isomerase
    Species: RALSTONIA SP. [TaxId:70356]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V6K (0-1)
    • Uniprot O86043 (2-213)
    Domains in SCOPe 2.08: d2v6ka1, d2v6ka2
  • Chain 'B':
    Compound: maleylpyruvate isomerase
    Species: RALSTONIA SP. [TaxId:70356]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V6K (0-1)
    • Uniprot O86043 (2-213)
    Domains in SCOPe 2.08: d2v6kb1, d2v6kb2
  • Heterogens: TGG, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2v6kA (A:)
akmklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtg
aqvliqspaiiewleeqyptpallpadadgrqrvralaaivgcdihpinnrrileylrkt
fgadeaainawcgtwisagfdayeallavdpkrgrysfgdtptladcylvpqvesarrfq
vdltpypliravdaacgeldafrraapaaqpdsa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2v6kB (B:)
akmklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtg
aqvliqspaiiewleeqyptpallpadadgrqrvralaaivgcdihpinnrrileylrkt
fgadeaainawcgtwisagfdayeallavdpkrgrysfgdtptladcylvpqvesarrfq
vdltpypliravdaacgeldafrraapaaqpdsa