PDB entry 2v6i

View 2v6i on RCSB PDB site
Description: kokobera virus helicase
Class: hydrolase
Keywords: membrane, helicase, hydrolase, RNA helicase, transmembrane, RNA replication, viral replication, nucleotide-binding
Deposited on 2007-07-18, released 2008-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.234
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA helicase
    Species: KOKOBERA VIRUS [TaxId:44024]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q32ZD5 (Start-430)
      • conflict (85)
      • conflict (167)
    Domains in SCOPe 2.06: d2v6ia1, d2v6ia2
  • Heterogens: POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v6iA (A:)
    kreltvldlhpgagktrrvlpqlvreavkkrlrtvilaptrvvasemyealrgepirymt
    pavqsertgneivdfmchstftmkllqgvrvpnynlyimdeahfldpasvaargyietrv
    smgdagaifmtatppgtteafppsnspiideetripdkawnsgyewitefdgrtvwfvhs
    ikqgaeigtclqkagkkvlylnrktfeseypkcksekwdfvittdisemganfkadrvid
    prktikpilldgrvsmqgpiaitpasaaqrrgrigrnpeklgdiyaysgnvssdneghvs
    wtearmlldnvhvqggvvaqlytperekteayegefklktnqrkvfselirtgdlpvwla
    fqvasanveyhdrkwcfdgpnehlllennqeievwtrqgqrrvlkprwldgritsdhlnl
    ksfkefasgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6iA (A:)
    reltvldlhpgagktrrvlpqlvreavkkrlrtvilaptrvvasemyealrgepirymgn
    eivdfmchstftmkllqgvrvpnynlyimdeahfldpasvaargyietrvsmgdagaifm
    tatppgtteafppsnspiideetripdkawnsgyewitefdgrtvwfvhsikqgaeigtc
    lqkagkkvlylnrktfeseypkcksekwdfvittdisemganfkadrvidprktikpill
    dgrvsmqgpiaitpasaaqrrgrigrnpeklgdiyaysgnvssdneghvswtearmlldn
    vhvqggvvaqlytperekteayegefklktnqrkvfselirtgdlpvwlafqvasanvey
    hdrkwcfdgpnehlllennqeievwtrqgqrrvlkprwldgritsdhlnlksfkefasgk
    r