PDB entry 2v6h

View 2v6h on RCSB PDB site
Description: Crystal structure of the C1 domain of cardiac myosin binding protein-C
Class: cell adhesion
Keywords: cell adhesion, phosphorylation, mybp-c c1 domain, disease mutation, muscle regulation, igi domain structure, muscle protein, cardiomyopathy, thick filament, immunoglobulin domain, hypertropic cardiomyopathy, polymorphism, actin-binding
Deposited on 2007-07-18, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myosin-binding protein C, cardiac-type
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14896 (0-107)
  Domains in SCOPe 2.08: d2v6ha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2v6hA (A:)
  ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
  dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v6hA (A:)
  ddpiglfvmrpqdgevtvggsitfsarvagkppvvkwfkgkwvdlsskvgqhlqlhdsyd
  raskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe