PDB entry 2v6h

View 2v6h on RCSB PDB site
Description: Crystal structure of the C1 domain of cardiac myosin binding protein-C
Class: cell adhesion
Keywords: cell adhesion, phosphorylation, mybp-c c1 domain, disease mutation, muscle regulation, igi domain structure, muscle protein, cardiomyopathy, thick filament, immunoglobulin domain, hypertropic cardiomyopathy, polymorphism, actin-binding
Deposited on 2007-07-18, released 2008-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, cardiac-type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v6ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v6hA (A:)
    ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
    dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6hA (A:)
    ddpiglfvmrpqdgevtvggsitfsarvagkppvvkwfkgkwvdlsskvgqhlqlhdsyd
    raskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe