PDB entry 2v6b

View 2v6b on RCSB PDB site
Description: crystal structure of lactate dehydrogenase from deinococcus radiodurans (apo form)
Class: oxidoreductase
Keywords: oxidoreductase, radioresistance, lactate dehydrogenase, ldh, nad, cytoplasm, mesophilic, glycolysis
Deposited on 2007-07-16, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v6ba1, d2v6ba2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v6bb1, d2v6bb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v6bc1, d2v6bc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2v6bd1, d2v6bd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v6bA (A:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
    lltdlatqlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawss
    amvagmpvadfmqaqnlpwneqvrakidegtrnaaasiiegkratyygigaalariteav
    lrdrravltvsaptpeygvslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfkq
    qlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6bA (A:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltalleknadifrelvpqitraapdavllvtsnpvdlltdlatqlapg
    qpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmpvadfm
    qaqnlpwneqvrakidegtrntyygigaalariteavlrdrravltvsaptpeygvslsl
    prvvgrqgvlstlhpkltgdeqqkleqsagvlrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v6bB (B:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
    lltdlatqlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawss
    amvagmpvadfmqaqnlpwneqvrakidegtrnaaasiiegkratyygigaalariteav
    lrdrravltvsaptpeygvslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfkq
    qlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6bB (B:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltagaesrldlleknadifrelvpqitraapdavllvtsnpvdlltdl
    atqlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvag
    mpvadfmqaqnlpwneqvrakidegtrtyygigaalariteavlrdrravltvsaptpey
    gvslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v6bC (C:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
    lltdlatqlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawss
    amvagmpvadfmqaqnlpwneqvrakidegtrnaaasiiegkratyygigaalariteav
    lrdrravltvsaptpeygvslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfkq
    qlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6bC (C:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltagsrldlleknadifrelvpqitraapdavllvtsnpvdlltdlat
    qlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmp
    vadfmqaqnlpwneqvrakidegtrntyygigaalariteavlrdrravltvsaptpeyg
    vslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v6bD (D:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltaganqkpgesrldlleknadifrelvpqitraapdavllvtsnpvd
    lltdlatqlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawss
    amvagmpvadfmqaqnlpwneqvrakidegtrnaaasiiegkratyygigaalariteav
    lrdrravltvsaptpeygvslslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgfkq
    qlgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v6bD (D:)
    mkvgvvgtgfvgstaafalvlrgscselvlvdrdedraqaeaediahaapvshgtrvwhg
    ghseladaqvviltagarldlleknadifrelvpqitraapdavllvtsnpvdlltdlat
    qlapgqpvigsgtvldsarfrhlmaqhagvdgthahgyvlgehgdsevlawssamvagmp
    vadfmqaqnlpwneqvrakidegtrtyygigaalariteavlrdrravltvsaptpeygv
    slslprvvgrqgvlstlhpkltgdeqqkleqsagvlrgf