PDB entry 2v69

View 2v69 on RCSB PDB site
Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit mutation d473e
Class: oxidoreductase
Keywords: large subunit loop 6 mutation, co2/o2 specificity, carbon dioxide fixation, photosynthesis, transit peptide, photorespiration, metal-binding, hydroxylation, oxidoreductase, methylation, chloroplast, calvin cycle, monooxygenase, lyase, rubisco, plastid, magnesium, acetylation
Deposited on 2007-07-14, released 2007-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69a1, d2v69a2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69b1, d2v69b2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69c1, d2v69c2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
      • engineered mutation (472)
    Domains in SCOPe 2.06: d2v69d1, d2v69d2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69e1, d2v69e2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69f1, d2v69f2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69g1, d2v69g2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877
      • conflict (45)
    Domains in SCOPe 2.06: d2v69h1, d2v69h2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69i_
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69j_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69k_
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69l_
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69m_
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69n_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69o_
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v69p_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v69A (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69A (A:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v69B (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69B (B:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v69C (C:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69C (C:)
    gfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwt
    dgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalr
    alrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemm
    kravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgihf
    rvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsm
    pgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqar
    negrdlareggdvirsackwspelaaacevwkeikfefd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v69D (D:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69D (D:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtiek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v69E (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69E (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v69F (F:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69F (F:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2v69G (G:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69G (G:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2v69H (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtiekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v69H (H:)
    gfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwt
    dgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalr
    alrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravye
    clrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemm
    kravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgihf
    rvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsm
    pgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqar
    negrdlareggdvirsackwspelaaacevwkeikfef
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69I (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69J (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69K (K:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69L (L:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69M (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69N (N:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69O (O:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v69P (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv