PDB entry 2v67

View 2v67 on RCSB PDB site
Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
Class: oxidoreductase
Keywords: large subunit loop 6 mutation, co2/o2 specificity, carbon dioxide fixation, photosynthesis, transit peptide, photorespiration, metal-binding, hydroxylation, oxidoreductase, methylation, chloroplast, calvin cycle, monooxygenase, lyase, rubisco, plastid, magnesium, acetylation
Deposited on 2007-07-13, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67a1, d2v67a2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67b1, d2v67b2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67c1, d2v67c2
  • Chain 'D':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67d1, d2v67d2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67e1, d2v67e2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67f1, d2v67f2
  • Chain 'G':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67g1, d2v67g2
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict see remark 9 (45)
      • engineered mutation (341)
    Domains in SCOPe 2.06: d2v67h1, d2v67h2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67i_
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67j_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67k_
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67l_
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67m_
  • Chain 'N':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67n_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67o_
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 1
    Species: CHLAMYDOMONAS REINHARDTII [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2v67p_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2v67A (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67A (A:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v67B (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67B (B:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2v67C (C:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67C (C:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2v67D (D:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67D (D:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2v67E (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67E (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2v67F (F:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67F (F:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2v67G (G:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67G (G:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2v67H (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v67H (H:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevilgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67I (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67J (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67K (K:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67L (L:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67M (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67N (N:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67O (O:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v67P (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpktardfqpankrsv