PDB entry 2v5v

View 2v5v on RCSB PDB site
Description: w57e flavodoxin from anabaena
Class: electron transport
Keywords: transport, electron transfer, electron transport
Deposited on 2007-07-10, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (0-168)
      • engineered mutation (0)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d2v5va_
  • Chain 'B':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3E0 (Start-168)
      • engineered mutation (56)
    Domains in SCOPe 2.07: d2v5vb_
  • Heterogens: FMN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v5vA (A:)
    akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptenig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2v5vB (B:)
    akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptenig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2v5vB (B:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptenige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl