PDB entry 2v5q

View 2v5q on RCSB PDB site
Description: crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Class: transferase
Keywords: design ankyrin repeat protein, transferase complex, phosphorylation, nucleotide-binding, serine/threonine-protein kinase, kinase, nucleus, transferase, ATP-binding, serine/threonine protein kinase
Deposited on 2007-07-08, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: design ankyrin repeat protein
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V5Q
    Domains in SCOPe 2.06: d2v5qc1, d2v5qc2
  • Chain 'D':
    Compound: design ankyrin repeat protein
    Species: unidentified [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 2V5Q
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2v5qC (C:)
mrgshhhhhhgsdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghl
eivevllkhgadvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhla
adeghleivevllkygadvnaqdkfgktafdisidngnedlakscrn

    Sequence, based on observed residues (ATOM records): (download) 
    >2v5qC (C:)
sdlgkklleaaragqddevriliangadvnavdntgltplhlaavsghleivevllkhga
dvdaadvygftplhlaamtghleivevllkygadvnafdmtgstplhlaadeghleivev
llkygadvna

  • Chain 'D':
    No sequence available.